DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ftz and Ubx

DIOPT Version :10

Sequence 1:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:58 Identity:46/58 - (79%)
Similarity:53/58 - (91%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 KRTRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSKKD 312
            :|.|||||||||||||||||.|.|:||||||::|:||.|:||||||||||||||.||:
  Fly   296 RRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKE 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ftzNP_477498.1 FTZ 1..248 CDD:397787
Homeodomain 255..311 CDD:459649 44/55 (80%)
KLF1_2_4_N <321..404 CDD:425360
UbxNP_536752.1 Homeodomain 296..352 CDD:459649 44/55 (80%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.