DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ftz and zen2

DIOPT Version :10

Sequence 1:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:135 Identity:50/135 - (37%)
Similarity:71/135 - (52%) Gaps:26/135 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 SKRTRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSKKDRTLDSS 318
            |||:|..::..|.:|||:|||.|:|:.|.|||:|:..|:|:|||:||||||||||.||......:
  Fly    43 SKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKGA 107

  Fly   319 PEHCGAGYTAMLPPLEATST----------------ATTGAPSVPVPMYHH-----HQTTAAYPA 362
               .||..|::  ||.:.|:                |.|...:.|:....|     .|.|..|.:
  Fly   108 ---IGALTTSI--PLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQVDHGVLEEGQITPPYQS 167

  Fly   363 YSHSH 367
            |.:.|
  Fly   168 YDYLH 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ftzNP_477498.1 FTZ 1..248 CDD:397787
Homeodomain 255..311 CDD:459649 32/55 (58%)
KLF1_2_4_N <321..404 CDD:425360 15/68 (22%)
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 32/55 (58%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.