DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ftz and cad

DIOPT Version :9

Sequence 1:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster


Alignment Length:385 Identity:100/385 - (25%)
Similarity:136/385 - (35%) Gaps:140/385 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 FYTTVEQVKKAPAVSTKVTASPAPSYDQEYV-TVPTPSASEDVD-----YLDVYSPQSQTQKLKN 185
            :|.:......|.|.|.....|||.|....:| .||| ||.:.:.     :....|..:.:....:
  Fly    65 YYNSHHMFHSAAAASAGEWHSPASSTADNFVQNVPT-SAHQLMQQHHHHHAHASSSSASSGSSSS 128

  Fly   186 GDFATPPPTT------------------------PTSLPP------LEGISTPP--------QSP 212
            |.....|...                        |.|.||      .||:.:||        .||
  Fly   129 GGAPGAPQLNETNSSIGVGGAGGGGGVGGATDGGPGSAPPNHQQHIAEGLPSPPITVSGSEISSP 193

  Fly   213 GEKSS------------SAV----------------------SQEINHRIVTAPNGAGDFNW--- 240
            |..:|            |||                      :..:::...|:|:....|:|   
  Fly   194 GAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNNRTSPSKPPYFDWMKK 258

  Fly   241 ----SHIEETLAS-----------DCKDSKRT----RQTYTRYQTLELEKEFHFNRYITRRRRID 286
                :..:..|:|           |.....||    |..||.:|.||||||:..:||||.||:.:
  Fly   259 PAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKSE 323

  Fly   287 IANALSLSERQIKIWFQNRRMKSKKDRTLDSSPEHCGAG-----YTAML-------PPLE----- 334
            :|..|||||||:||||||||.|.:|.....|.|...|.|     |:.:|       |.|.     
  Fly   324 LAQTLSLSERQVKIWFQNRRAKERKQNKKGSDPNVMGVGVQHADYSQLLDAKAKLEPGLHLSHSL 388

  Fly   335 ATSTATTGAPSVPVPMYHHHQTTAAYPAYSHS------HSHGYGLLNDYPQQQTHQQYDA 388
            |.|.....|.::|....|.|     ..|:|||      |||           |..||:.|
  Fly   389 AHSMNPMAAMNIPAMRLHPH-----LAAHSHSLAAVAAHSH-----------QLQQQHSA 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ftzNP_477498.1 FTZ 1..248 CDD:281812 36/205 (18%)
Homeobox 257..310 CDD:278475 34/56 (61%)
cadNP_001260641.1 Homeobox 295..347 CDD:278475 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.