DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ftz and HOXC6

DIOPT Version :10

Sequence 1:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_004494.1 Gene:HOXC6 / 3223 HGNCID:5128 Length:235 Species:Homo sapiens


Alignment Length:117 Identity:21/117 - (17%)
Similarity:48/117 - (41%) Gaps:24/117 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 NVEMDEPAQ----KYSTTKGINANPFWEETFDFDLTPATEEIL-FEIYEGNDKLHMNDDEGFLGL 395
            ::|:...||    :.....|:.....|::|.:.......:::| :.:.:|...:.|...:.|..:
Human   116 SLELPPQAQAEDGRSQAAVGVTPEGTWQDTSELHRQEEAKQVLRYYVLQGQRYVWMETQQAFCQV 180

  Fly   396 AIVNFEEIRRSGETVH----SLKLQGRPYRKDAISGEITVQFDFFYDPNLLT 443
            ::::.   .|:.:.||    .|.||.:..||.            .|.||:::
Human   181 SLLDH---GRTCDDVHCSSSGLSLQDQATRKT------------IYGPNVIS 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ftzNP_477498.1 FTZ 1..248 CDD:397787
Homeodomain 255..311 CDD:459649
KLF1_2_4_N <321..404 CDD:425360 10/72 (14%)
HOXC6NP_004494.1 Antp-type hexapeptide 122..127 2/4 (50%)
Homeodomain 142..198 CDD:459649 9/58 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..235 7/30 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.