DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ftz and HOXB1

DIOPT Version :10

Sequence 1:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_002135.2 Gene:HOXB1 / 3211 HGNCID:5111 Length:301 Species:Homo sapiens


Alignment Length:174 Identity:37/174 - (21%)
Similarity:64/174 - (36%) Gaps:45/174 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   633 NQLLEEAVSLPPSRDPSRTRYAVSSNDKYRETHSVGGRSGESTKSLYQHSTLILELDQDK----- 692
            :|::|.......|.|.:|.|..:...|.            |..:..||...|:...|.::     
Human   100 HQVIEVTAYNRDSFDTTRQRLLLLIGDP------------EGPRLPYQAEFLVRSHDVEEVLPST 152

  Fly   693 QAKYFLIPPAMLNEPAASRLMR---------------KGKKLHIYNDHTFVAVKVKGGATCNVCQ 742
            .|..||.....|.||...:|:.               :|:|..:|       :||......:.|.
Human   153 PANRFLTALGGLWEPGELQLLNITSALDRGGRVPLPIEGRKEGVY-------IKVGSATPFSTCL 210

  Fly   743 QRIRS--SFSKQAYQCRDCKMVCHKTC--HYKTDAFCTQSNVSK 782
            :.:.|  |:::.| |.:...:.|:.|.  |::.| :|..|.|.|
Human   211 KMVASPDSYARCA-QGQPPLLSCYDTLAPHFRVD-WCNVSLVDK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ftzNP_477498.1 FTZ 1..248 CDD:397787
Homeodomain 255..311 CDD:459649
KLF1_2_4_N <321..404 CDD:425360
HOXB1NP_002135.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..77
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..149 5/33 (15%)
Antp-type hexapeptide 179..184 0/4 (0%)
Homeodomain 207..260 CDD:459649 13/48 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.