DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ftz and nob-1

DIOPT Version :9

Sequence 1:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001369824.1 Gene:nob-1 / 176641 WormBaseID:WBGene00003779 Length:243 Species:Caenorhabditis elegans


Alignment Length:210 Identity:67/210 - (31%)
Similarity:94/210 - (44%) Gaps:37/210 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 APAVSTKVTASPAPSYDQEYVTVPT--PSASE-----DVDYLDVY-SPQSQTQKLKNGDFATPPP 193
            :|.::...|....|.....|...|:  |:|:|     :..|.|.| :|.:.|     |.::...|
 Worm    56 SPQLAPSSTGMVMPGTAGMYGFGPSRMPTANEFGMMMNPVYTDFYQNPLAST-----GWYSYGQP 115

  Fly   194 ---TTPTSLPPLEGISTPPQSPGEKSSSAVSQEINHRIVTAPNGAGDFNW--SHIEETLASDCKD 253
               |...|:|.|:|..:....|....|||         .|.||.|....|  ||          |
 Worm   116 YQFTANYSIPSLDGNLSDITIPTTAGSSA---------ATTPNAAMHLPWAISH----------D 161

  Fly   254 SKRTRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSKKDRTLDSS 318
            .|:.||.|.:.|...||.|:..|:|:|.:||.:::..|.|.|:|:|:||||||||.||.|...|.
 Worm   162 GKKKRQPYKKDQISRLEYEYSVNQYLTNKRRSELSAQLMLDEKQVKVWFQNRRMKDKKLRQRHSG 226

  Fly   319 PEHCGAGYTAMLPPL 333
            |...||..|..:..|
 Worm   227 PFPHGAPVTPCIERL 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ftzNP_477498.1 FTZ 1..248 CDD:281812 31/123 (25%)
Homeobox 257..310 CDD:278475 25/52 (48%)
nob-1NP_001369824.1 Homeobox 165..219 CDD:395001 25/53 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.