DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ftz and mab-5

DIOPT Version :10

Sequence 1:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_498695.1 Gene:mab-5 / 176091 WormBaseID:WBGene00003102 Length:200 Species:Caenorhabditis elegans


Alignment Length:121 Identity:54/121 - (44%)
Similarity:74/121 - (61%) Gaps:21/121 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 TTPTSLPPLEGISTPPQSPGEKSSS--AVSQEINHRIVTAPNGAGDFNWSHIEETLASDCKDSKR 256
            :.|.:..||:..|.   :.||..:|  |:||.:             |.|..:......   :|||
 Worm    74 SNPFAYNPLQATSA---NFGETRTSMPAISQPV-------------FPWMKMGGAKGG---ESKR 119

  Fly   257 TRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSKKD 312
            |||||:|.||||||||||:::|:||:||.:|:..|.|:|||:||||||||||.||:
 Worm   120 TRQTYSRSQTLELEKEFHYHKYLTRKRRQEISETLHLTERQVKIWFQNRRMKHKKE 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ftzNP_477498.1 FTZ 1..248 CDD:397787 12/55 (22%)
Homeodomain 255..311 CDD:459649 39/55 (71%)
KLF1_2_4_N <321..404 CDD:425360
mab-5NP_498695.1 Homeodomain 118..174 CDD:459649 39/55 (71%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.