DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ftz and Hoxb9

DIOPT Version :10

Sequence 1:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_032296.2 Gene:Hoxb9 / 15417 MGIID:96190 Length:250 Species:Mus musculus


Alignment Length:178 Identity:63/178 - (35%)
Similarity:83/178 - (46%) Gaps:37/178 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 APSYDQEYVTV---PTPSASEDVDYLDVYSPQSQT------------QKLKNGDFATPPPTTPTS 198
            ||:.:..|:..   |.|.|       :....|.|.            :.||.|   ||..:..||
Mouse    87 APAAESRYLRTWLEPAPRA-------EAAPGQGQAAVKAEPLLGAPGELLKQG---TPEYSLETS 141

  Fly   199 LPPLEGISTPPQSPGEKSSSAVSQEINHRIVTAPNGAGDFNWSHIEETLASDCKDSKRTRQTYTR 263
            ......:|......|:......|::......|.|:.    ||.|        .:.|::.|..||:
Mouse   142 AGREAVLSNQRAGYGDNKICEGSEDKERPDQTNPSA----NWLH--------A
RSSRKKRCPYTK 194

  Fly   264 YQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSKK 311
            ||||||||||.||.|:||.||.::|..|:|||||:||||||||||.||
Mouse   195 YQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ftzNP_477498.1 FTZ 1..248 CDD:397787 23/113 (20%)
Homeodomain 255..311 CDD:459649 37/55 (67%)
KLF1_2_4_N <321..404 CDD:425360
Hoxb9NP_032296.2 Hox9_act 1..172 CDD:461369 18/94 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..48
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..182 6/33 (18%)
Homeodomain 186..242 CDD:459649 37/55 (67%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.