DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and LBX2

DIOPT Version :10

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001269359.1 Gene:LBX2 / 85474 HGNCID:15525 Length:198 Species:Homo sapiens


Alignment Length:134 Identity:40/134 - (29%)
Similarity:58/134 - (43%) Gaps:25/134 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 VSGGPGNVNVPMHSPGG-------GDSDSESDSGNEAGSSQNSGNGKKNPPQIYP---WMKRVHL 313
            |...|....:|...||.       .:..|::..|.:|.:.|.| .|:..|..:.|   ..||   
Human    25 VPRAPSAPQLPESGPGPTSPLCALEELTSKTFRGLDARALQPS-EGRAGPDALGPGPFGRKR--- 85

  Fly   314 GTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMK 378
                       ::.||::|..|.||||:.|.|.:||....|..:|..|.|...|:..||||||.|
Human    86 -----------RKSRTAFTAQQVLELERRFVFQKYLAPSERDGLATRLGLANAQVVTWFQNRRAK 139

  Fly   379 WKKE 382
            .|::
Human   140 LKRD 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeodomain 325..381 CDD:459649 24/55 (44%)
LBX2NP_001269359.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..46 5/20 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..89 7/40 (18%)
Homeodomain 86..142 CDD:459649 24/55 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..198
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.