DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and HB18

DIOPT Version :10

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_177248.3 Gene:HB18 / 843431 AraportID:AT1G70920 Length:206 Species:Arabidopsis thaliana


Alignment Length:120 Identity:33/120 - (27%)
Similarity:58/120 - (48%) Gaps:10/120 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 VNVPMHSPGGGDSDSESDSGNEAGSSQNSGNGKKNPPQIYPWM--KRVHLGTSTVNANGETKRQR 328
            :::|..||       ....|:..|......|......:...||  ...|:.....|:.|. :|::
plant    14 ISIPSFSP-------SPSLGDHHGMRDFDINQTPKTEEDREWMIGATPHVNEDDSNSGGR-RRKK 70

  Fly   329 TSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEH 383
            ...|:.|:..||:.|..|..||.:::.::|..|.|::||:::||||||.:.|.:|
plant    71 LRLTKEQSHLLEESFIQNHTLTPKQKKDLATFLKLSQRQVEVWFQNRRARSKLKH 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeodomain 325..381 CDD:459649 20/55 (36%)
HB18NP_177248.3 HOX 66..122 CDD:197696 20/56 (36%)
HALZ 124..167 CDD:128634 1/2 (50%)

Return to query results.
Submit another query.