DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and HB51

DIOPT Version :10

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_195999.2 Gene:HB51 / 831723 AraportID:AT5G03790 Length:235 Species:Arabidopsis thaliana


Alignment Length:122 Identity:39/122 - (31%)
Similarity:57/122 - (46%) Gaps:8/122 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 NVNVPMHSPGGGDSDSESD--SGN---EAGSSQNSGNGKKNPPQIYPWMKRVHLGTSTVNANGE- 323
            ||.|....|...:|.|.:.  |.|   .||:|...|:.:..|....|..:::.......|.|.| 
plant    11 NVRVAFMPPPWPESSSFNSLHSFNFDPYAGNSYTPGDTQTGPVISVPESEKIMNAYRFPNNNNEM 75

  Fly   324 TKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWK 380
            .|::|  .|..|...||:.|.....|...|:::::..|.|..|||.:||||||.:||
plant    76 IKKKR--LTSGQLASLERSFQEEIKLDSDRKVKLSRELGLQPRQIAVWFQNRRARWK 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeodomain 325..381 CDD:459649 22/56 (39%)
HB51NP_195999.2 Homeodomain 77..130 CDD:459649 20/54 (37%)
HALZ 132..166 CDD:460477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.