DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and gsx1

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001039254.1 Gene:gsx1 / 734120 XenbaseID:XB-GENE-855502 Length:243 Species:Xenopus tropicalis


Alignment Length:215 Identity:65/215 - (30%)
Similarity:89/215 - (41%) Gaps:67/215 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 AGLNNNHS---GSGVSGGPG--NVNVPMHSPGGGDSDSESDSGNEAGSSQNSGNGKKNPPQIYPW 307
            |||...||   |..||.||.  ....|:..|......|...|.::..||                
 Frog    89 AGLGRQHSASTGINVSHGPALYQAAYPLPDPRQFHCISVDSSPSQLSSS---------------- 137

  Fly   308 MKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWF 372
                             ||.||::|..|.||||:||..|.||:|.||||||..|.|:|:|:||||
 Frog   138 -----------------KRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWF 185

  Fly   373 QNRRMKWKKEHKMASMNIVPYHMGPYGHPYHQFDIHPSQFAHLSAXDAWHFSGTGXRLNQLYQEP 437
            ||||:|.|||.|.::               |:...|..:.:.||              ::..:|.
 Frog   186 QNRRVKHKKEGKSST---------------HRASPHGCKCSSLS--------------SKCLEED 221

  Fly   438 YQTAAAASAASGYQSQDGGP 457
            .:..|.:.::||...:|..|
 Frog   222 DEDLAMSPSSSGKDDRDLSP 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 33/52 (63%)
gsx1NP_001039254.1 homeobox 137..196 38/91 (42%)
Homeobox 141..194 CDD:365835 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.