DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and Hoxa6

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001178016.1 Gene:Hoxa6 / 685732 RGDID:1590236 Length:233 Species:Rattus norvegicus


Alignment Length:134 Identity:74/134 - (55%)
Similarity:93/134 - (69%) Gaps:11/134 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 SGSGVSGGPGNVNVPMH-SPGGGDSDSESDSGNEAGSS-QNSGNGKKNPPQIYPWMKRVHLGTST 317
            ||:....|||:.   :| ||   :...:.||.:..|.: ...|..:|....:||||:|::.....
  Rat    91 SGNSKQRGPGDY---LHFSP---EQQYKPDSSSVQGKALHEEGTDRKYTSPVYPWMQRMNSCAGA 149

  Fly   318 V-NANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK 381
            | .::|  :|.|.:||||||||||||||||||||||||||||:||||||||||||||||||||||
  Rat   150 VYGSHG--RRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKK 212

  Fly   382 EHKM 385
            |:|:
  Rat   213 ENKL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 49/52 (94%)
Hoxa6NP_001178016.1 Homeobox 159..212 CDD:395001 49/52 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.