DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and hoxb6b

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_571613.1 Gene:hoxb6b / 58053 ZFINID:ZDB-GENE-000823-7 Length:224 Species:Danio rerio


Alignment Length:237 Identity:89/237 - (37%)
Similarity:114/237 - (48%) Gaps:47/237 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 ISCKYAND--PVT-PGGSG---------GGGVSGSNNNNNSANSNNNNSQSLASPQDLSTRDISP 217
            :|..:.|.  ||: |||..         ..|.:.|..:..||.....|.|.              
Zfish     1 MSSYFVNSTFPVSLPGGQESFLGQIPLYSSGYTDSLRHYPSATFGATNVQD-------------- 51

  Fly   218 KLSPSSVVESVARSLNKGVLGGSLAAAAAAAGLNNNHSGSGVSGGPGNVNVPMHSPGGGDS---- 278
            |:..||..:...     ||.|.|.:.:|......|.:..:..|...|::.         ||    
Zfish    52 KVYTSSYYQQAG-----GVFGRSGSTSACDYSTPNIYRSADRSCAIGSLE---------DSLVLT 102

  Fly   279 -DSESDSGNEAGSSQNSGNGKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKE 342
             |.......|.|:.:......|....:||||:|::.......:.|  :|.|.:|||:||||||||
Zfish   103 QDQCKTDCTEQGTERYFSTEDKPCTPVYPWMQRMNSCNGMPGSTG--RRGRQTYTRFQTLELEKE 165

  Fly   343 FHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHK 384
            |||||||||||||||:||||||||||||||||||||||||:|
Zfish   166 FHFNRYLTRRRRIEISHALCLTERQIKIWFQNRRMKWKKENK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 48/52 (92%)
hoxb6bNP_571613.1 Antp-type hexapeptide 129..134 3/4 (75%)
Homeobox 151..203 CDD:278475 47/51 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.