DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and hoxa9b

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_571608.1 Gene:hoxa9b / 58048 ZFINID:ZDB-GENE-000823-2 Length:258 Species:Danio rerio


Alignment Length:270 Identity:82/270 - (30%)
Similarity:122/270 - (45%) Gaps:66/270 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 AAAAVAAQQQQQLAQQQHPQQQQQQQQANISCKYAN-DPVTPGGSGGGGVSGSNNNNNSANSNNN 199
            ::..|..||.::|...::.:|:....||..|...|: .||.|.|:   .::.....::..::.::
Zfish    28 SSGPVVQQQSRELTLLEYSEQEPYTFQAKSSIFGASWSPVQPTGA---SIAYHPYIHHPCSTGDS 89

  Fly   200 NSQSL---------ASP-QDLST---RDISPKLSPSSVVESVARSLNKGVLGGSLAAAAAAAGLN 251
            :..|:         |.| ..|||   :||  ||.|  :|.|          |.........|..:
Zfish    90 DGASVRPWALEPLPALPFTGLSTDTHQDI--KLEP--LVGS----------GECTTHTLLVAETD 140

  Fly   252 NNHS-------GSGVSGGPGNVNVPMHSPGGGDSDSESDSGNEAGSSQNSGNGKKNPPQIYPWMK 309
            ||.:       ...||.|..:..:|      .::..:.|.     |..|..|...|      |: 
Zfish   141 NNTTQTERKVPDDAVSNGSHDEKIP------AETKLDLDP-----SKCNQDNPLSN------WL- 187

  Fly   310 RVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQN 374
              |..:        |:::|..||::|||||||||.||.||:|.||.|:|..|.|||||:||||||
Zfish   188 --HAKS--------TRKKRCPYTKHQTLELEKEFLFNMYLSRDRRYEVARLLNLTERQVKIWFQN 242

  Fly   375 RRMKWKKEHK 384
            ||||.||.:|
Zfish   243 RRMKMKKCNK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 37/52 (71%)
hoxa9bNP_571608.1 Hox9_act 1..174 CDD:282473 34/168 (20%)
Homeobox 195..248 CDD:278475 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.