DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and Hoxb4

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001094257.1 Gene:Hoxb4 / 497988 RGDID:1560113 Length:250 Species:Rattus norvegicus


Alignment Length:266 Identity:93/266 - (34%)
Similarity:109/266 - (40%) Gaps:108/266 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 PKLSPSSVVESVARSLNKGVLGGSLAAAAAAAGLNNNHSGSGVSGGPGNVNVPMHSPGGGDSDSE 281
            |.|||.:.|:|.|            .|.....|..:....|.....|...| |:|......:..|
  Rat    86 PGLSPRAPVQSTA------------GALLPEPGQRSEVVSSSPPPPPCAQN-PLHPSPSHSACKE 137

  Fly   282 SDSGNEAGSSQNSGNGKKNPPQIYPWMKRVHLGTSTVNAN---GETKRQRTSYTRYQTLELEKEF 343
                                |.:||||::||:  ||||.|   ||.||.||:|||.|.|||||||
  Rat   138 --------------------PVVYPWMRKVHV--STVNPNYAGGEPKRSRTAYTRQQVLELEKEF 180

  Fly   344 HFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNIVPYHMGPYGHPYHQFDIH 408
            |:|||||||||:||||||||:|||||||||||||||||:||:.:..|                  
  Rat   181 HYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKWKKDHKLPNTKI------------------ 227

  Fly   409 PSQFAHLSAXDAWHFSGTGXRLNQLYQEPYQTAAAASAASGYQSQDGGPIGGGSVGVGGGAGGPG 473
                                                  .||              |..|.||||.
  Rat   228 --------------------------------------RSG--------------GTAGAAGGPP 240

  Fly   474 SLANGG 479
            ...|||
  Rat   241 GRPNGG 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 46/52 (88%)
Hoxb4NP_001094257.1 Homeobox 164..218 CDD:395001 46/53 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45771
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.