DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and hoxa1

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001008017.1 Gene:hoxa1 / 493379 XenbaseID:XB-GENE-480737 Length:323 Species:Xenopus tropicalis


Alignment Length:237 Identity:77/237 - (32%)
Similarity:112/237 - (47%) Gaps:32/237 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 GGGV---SGSNNNNNSANS---NNNNSQS---LASPQDLSTRDISPKLS--PSSVVESVARSLNK 234
            |.||   |..:::::.|.:   :||...|   .:...:...::.||..|  |.:....|:....:
 Frog    56 GRGVQISSHPHHHHHQAGAFQHHNNLGMSYTHTSCGSNYGMQNFSPGYSHFPINQEADVSAGFPQ 120

  Fly   235 GVLGGSLAAAAAAAGLNNNHSGSGVSGGPGNVNVPMHSPGGGDSDSESDSGNEAGS---SQN--- 293
            .|..|::|::.    :.::...|.:.|....::   ||.|...:.|.::..|...|   ||.   
 Frog   121 SVYSGNIASSV----VQHHQHQSYIEGSAHYIH---HSYGPDQNISVANYNNNVSSLHISQREVC 178

  Fly   294 ---SGNGKKNPPQIYPWMKRVHLGTSTVNAN-----GETKRQRTSYTRYQTLELEKEFHFNRYLT 350
               |......|.|.:.|||.......|..|.     |:....||::|..|..|||||||||:|||
 Frog   179 RSPSSETSPGPAQTFDWMKVKRNPPKTGKAGEYGFAGQPNTARTNFTTKQLTELEKEFHFNKYLT 243

  Fly   351 RRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNIVP 392
            |.||:|||.||.|.|.|:||||||||||.||..|...:.|.|
 Frog   244 RARRVEIAAALQLNETQVKIWFQNRRMKQKKREKEGLLPISP 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 37/52 (71%)
hoxa1NP_001008017.1 Homeobox 221..274 CDD:365835 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.