DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and hoxc8

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001006787.1 Gene:hoxc8 / 448482 XenbaseID:XB-GENE-480999 Length:242 Species:Xenopus tropicalis


Alignment Length:193 Identity:77/193 - (39%)
Similarity:95/193 - (49%) Gaps:49/193 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 ESVARSLNKGVLGGSLAAAAAAAGLNN---------NH-----SGSGVSGGP------------- 263
            :||:|| :..|.|.|    |.|.|..:         :|     |.||....|             
 Frog    30 QSVSRS-HALVYGPS----ATAPGFQHPSHHVQEFFHHGSSSLSNSGFQQNPCALTCHGDASKFY 89

  Fly   264 GNVNVPMHSPGGGDS--------DSESDSGNEAGSSQNSGNGKKNPPQIYPWMKRVHLGTSTVNA 320
            |...:|..|..|...        |.:|.|.......|...|...:|..::||| |.|       |
 Frog    90 GYEALPRQSLYGAQQEASVVQYPDCKSSSNTNTSEGQGHLNQNSSPSLMFPWM-RPH-------A 146

  Fly   321 NGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEH 383
            .|. :..|.:|:|||||||||||.||.||||:||||::|||.|||||:||||||||||||||:
 Frog   147 PGR-RSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKEN 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 42/52 (81%)
hoxc8NP_001006787.1 Homeobox 153..206 CDD:365835 42/52 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.