DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and meox1

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001002450.2 Gene:meox1 / 436723 ZFINID:ZDB-GENE-040718-149 Length:253 Species:Danio rerio


Alignment Length:291 Identity:71/291 - (24%)
Similarity:101/291 - (34%) Gaps:102/291 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 GGQGNPDMVDYTQLQPQRLLLQQQQQQQQQQHAHAA-----------AAVAAQQQQQLAQQQHPQ 155
            ||.|       ..:||    .||......|:|...|           |..|..::.:|..:.|..
Zfish    28 GGSG-------AGIQP----YQQAPFALHQKHDFLAYTDFSSSCLVPAPHAYPREDRLYPETHSG 81

  Fly   156 QQQQQQQANISCKYANDPVTPGGSGGGGVSGSNNNNNSANSNNNNSQSLASPQDLSTRDISPKLS 220
            .|:.:.|.:        |..|.|.|.....|:                                 
Zfish    82 YQRTEWQFS--------PCEPRGRGQEPCQGA--------------------------------- 105

  Fly   221 PSSVVESVARSLNKGVLGGSLAAAAAAAGLNNNHSGSGVSGGPGNVNVPMHSPGGGDSDSESDSG 285
                .|:|...::..  ||...|.|....|..::|             |...|........|...
Zfish   106 ----AEAVGAEMDSA--GGDRLAGAVTGCLEGDYS-------------PQSVPAVDTEKKSSKRK 151

  Fly   286 NEAGSSQNSGNGKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLT 350
            .|....|:|                    :...::|.:.:::||::|:.|..|||.||..:.|||
Zfish   152 REVTDIQDS--------------------SFKADSNCKARKERTAFTKEQLRELEAEFTHHNYLT 196

  Fly   351 RRRRIEIAHALCLTERQIKIWFQNRRMKWKK 381
            |.||.|||..|.|||||:|:||||||||||:
Zfish   197 RLRRYEIAVNLDLTERQVKVWFQNRRMKWKR 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 34/52 (65%)
meox1NP_001002450.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..158 3/21 (14%)
Homeobox 174..226 CDD:278475 33/51 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..253 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.