DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and ro

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster


Alignment Length:286 Identity:76/286 - (26%)
Similarity:99/286 - (34%) Gaps:108/286 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 SGGPGNVNVPMHSPGGGDSDSESDSGNEAGSSQNSGNGKKNPPQIYPWMKRVHLGTSTVNANGET 324
            :||..|..:|...|.|..||....:|..|..::..                        ...|..
  Fly   151 AGGAANPVLPHAFPAGFPSDPHFSAGFSAFLARRR------------------------RKEGRQ 191

  Fly   325 KRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMN 389
            :||||:::..|||.||.|||.|.|::|.||.|:|..|.|||.||||||||||.|.|:..|.    
  Fly   192 RRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKA---- 252

  Fly   390 IVPYHMGPYGHPYHQFDIHPSQFAHLSAXDAWHFSGTGXRLNQLYQEPYQTAAAASAASGYQSQ- 453
                          |.|.|...|.                                .|:|:.|. 
  Fly   253 --------------QIDQHYRNFV--------------------------------VANGFMSSI 271

  Fly   454 ---------DGGPIGGGSVGVG----GGAGGPGSLANGGSNGSGPNSLFASAASSSQAPDCIKYP 505
                     .||..||.:||||    ..|..|.:|..                .::|..:.|...
  Fly   272 MGQAATTMPPGGVTGGVAVGVGLNYYAAAATPAALPK----------------DNTQDANFIDID 320

  Fly   506 QEFXSQVIIRQQHQQQQDNSMDRNQE 531
            .:| .|    ||.:|||.....|.:|
  Fly   321 DQFQRQ----QQQKQQQQQQQQRRRE 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 32/52 (62%)
roNP_524521.1 Homeobox 196..247 CDD:278475 31/50 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439772
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.