DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and btn

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster


Alignment Length:132 Identity:50/132 - (37%)
Similarity:71/132 - (53%) Gaps:20/132 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 HSPGGGDSD---SESDSGNEAGSS--QNSG-NGKKNPPQIYPWMKRVHLGTSTVNANGETKRQRT 329
            ||.....:|   .|::..|||...  ||.. .|::.|.|           .|.:.|....:::||
  Fly    38 HSASSSYADYNKLETNWCNEANDQWLQNEAPTGQELPSQ-----------RSKLRAISSNRKERT 91

  Fly   330 SYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK---EHKMASMNIV 391
            ::::.|..:||.||.::.||||.||.|||.||.|||||:|:||||||||.|:   |.:..|....
  Fly    92 AFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLEEQQGSSAKT 156

  Fly   392 PY 393
            |:
  Fly   157 PF 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 32/52 (62%)
btnNP_732768.1 Homeobox 90..142 CDD:278475 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
54.810

Return to query results.
Submit another query.