DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and bcd

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster


Alignment Length:253 Identity:69/253 - (27%)
Similarity:98/253 - (38%) Gaps:63/253 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 KRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWK---KEHKMA 386
            :|.||::|..|..|||:.|...||||..|..:::..|.|...|:||||:|||.:.|   .:||..
  Fly    98 RRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQ 162

  Fly   387 SMNIVPYHMGPYGHPYHQFDIHPSQFAHLSAXDAWHFSGTGXRLNQLYQEP-------YQTAAAA 444
            |...:|...|     ..|.|..|.....||.       |.|...|.|...|       :.|...:
  Fly   163 SYEGMPLSPG-----MKQSDGDPPSLQTLSL-------GGGATPNALTPSPTPSTPTAHMTEHYS 215

  Fly   445 SAASGYQSQDGG--------------PIGGGSVGVGGGAGGPGSL-ANGGSNGSGPNSLFASAAS 494
            .:.:.|.:.:||              |.|||.        ||||. .|||.        |.....
  Fly   216 ESFNAYYNYNGGHNHAQANRHMHMQYPSGGGP--------GPGSTNVNGGQ--------FFQQQQ 264

  Fly   495 SSQAPDCIKY-----PQEFXSQVIIRQQHQQQQDNSMD--RNQERDLKLLLETDCEPD 545
            .......:.:     |.:...|   :||.||||.:..|  :.|....::|::.:.|.|
  Fly   265 VHNHQQQLHHQGNHVPHQMQQQ---QQQAQQQQYHHFDFQQKQASACRVLVKDEPEAD 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 24/55 (44%)
bcdNP_788587.1 Homeobox 106..153 CDD:278475 20/46 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439773
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.