DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and hhex

DIOPT Version :10

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_989420.1 Gene:hhex / 395060 XenbaseID:XB-GENE-487159 Length:274 Species:Xenopus tropicalis


Alignment Length:57 Identity:26/57 - (45%)
Similarity:38/57 - (66%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 KRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK 381
            |..:..::..||:||||:|...:||:...|..:|..|.|:|||:|.||||||.||::
 Frog   140 KGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRR 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeodomain 325..381 CDD:459649 26/55 (47%)
hhexNP_989420.1 Homeodomain 138..196 CDD:459649 26/55 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..274 26/57 (46%)

Return to query results.
Submit another query.