DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and cad

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster


Alignment Length:438 Identity:109/438 - (24%)
Similarity:168/438 - (38%) Gaps:118/438 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 AAAAYTPNLYPNTPQAHYANQAAYGGQGNPDMVDYTQLQPQRLLLQQQQQQQQQQHAHAAAAVAA 142
            ||||:  .:|.|:....::..||..|:.:...........|.:.....|..||..|.||.|:.::
  Fly    58 AAAAH--QMYYNSHHMFHSAAAASAGEWHSPASSTADNFVQNVPTSAHQLMQQHHHHHAHASSSS 120

  Fly   143 QQQQQLAQQQHPQQQQQQQQANISCKYANDPVTPGGSGGGGVSGSNNNNNSANSNNNNSQSLAS- 206
            ......:....|...|..:        .|..:..||:||||..|...:....::..|:.|.:|. 
  Fly   121 ASSGSSSSGGAPGAPQLNE--------TNSSIGVGGAGGGGGVGGATDGGPGSAPPNHQQHIAEG 177

  Fly   207 ----PQDLSTRDISPKLSPSSVVESVARSLNKGVLGGSLAAAAAAAGLNNNHSGSGVSGGPGNVN 267
                |..:|..:||...:|:|.      |.....|...|:|.|     |||::.:..:..|    
  Fly   178 LPSPPITVSGSEISSPGAPTSA------SSPHHHLAHHLSAVA-----NNNNNNNNNNNSP---- 227

  Fly   268 VPMHSPGGGDSDSESDSGNEAGSSQNSGNGKKNPPQIYPWMKR--------VHLGTS-------- 316
                        |..::.|...|..|:.....:.|..:.|||:        ..|.:|        
  Fly   228 ------------STHNNNNNNNSVSNNNRTSPSKPPYFDWMKKPAYPAQPQPDLSSSPNLEDLSD 280

  Fly   317 TVNANGETK---RQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMK 378
            .::|:|:|:   :.|..||.:|.||||||:..:||:|.||:.|:|..|.|:|||:||||||||.|
  Fly   281 LLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAK 345

  Fly   379 WKKEHK-------------------------------------------MASMNIVPYHMGPYGH 400
            .:|::|                                           ||:|||....:    |
  Fly   346 ERKQNKKGSDPNVMGVGVQHADYSQLLDAKAKLEPGLHLSHSLAHSMNPMAAMNIPAMRL----H 406

  Fly   401 PYHQFDIHPSQFAHLSAXDAWHFSGTGXRLNQLYQEPYQTAAAASAAS 448
            |      |.:..:|..|..|.|    ..:|.|.:......|||....|
  Fly   407 P------HLAAHSHSLAAVAAH----SHQLQQQHSAQMSAAAAVGTLS 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 31/52 (60%)
cadNP_001260641.1 Homeobox 295..347 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
32.910

Return to query results.
Submit another query.