Sequence 1: | NP_001368995.1 | Gene: | Scr / 40833 | FlyBaseID: | FBgn0003339 | Length: | 564 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_055436.2 | Gene: | HOXD4 / 3233 | HGNCID: | 5138 | Length: | 255 | Species: | Homo sapiens |
Alignment Length: | 260 | Identity: | 99/260 - (38%) |
---|---|---|---|
Similarity: | 121/260 - (46%) | Gaps: | 84/260 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 210 LSTRDISPKLSPSSVVESVARSLNKGVL---------GGSLAAAAAAAGL-------NNNHSGSG 258
Fly 259 VS--------------GGPGNVNVPMH--SPG---------------GGDSDSESDSGNEAGSSQ 292
Fly 293 NSGNGKKNPPQIYPWMKRVHLGTSTVNAN---GETKRQRTSYTRYQTLELEKEFHFNRYLTRRRR 354
Fly 355 IEIAHALCLTERQIKIWFQNRRMKWKKEHKM---------------ASMNIVP-YHMGPYGHPYH 403
Fly 404 403 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Scr | NP_001368995.1 | Homeobox | 328..381 | CDD:395001 | 47/52 (90%) |
HOXD4 | NP_055436.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 31..127 | 21/105 (20%) | |
Antp-type hexapeptide | 133..138 | 3/4 (75%) | |||
Homeobox | 157..210 | CDD:306543 | 46/52 (88%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 212..255 | 7/38 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 170 | 1.000 | Inparanoid score | I4116 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45771 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X14 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.960 |