DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and HOXC6

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_004494.1 Gene:HOXC6 / 3223 HGNCID:5128 Length:235 Species:Homo sapiens


Alignment Length:230 Identity:89/230 - (38%)
Similarity:109/230 - (47%) Gaps:61/230 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 NSANSNNNNSQSLASPQDLSTRDISPKLSPSSVVESVARSLNKGVLGGSLAAAAAAAGLNNNHSG 256
            ||..:|.:.|..||..|     |:.|.::.:|......|         ..:...||...|..:| 
Human     2 NSYFTNPSLSCHLAGGQ-----DVLPNVALNSTAYDPVR---------HFSTYGAAVAQNRIYS- 51

  Fly   257 SGVSGGPGNVNVPMHSPGGGDSDSESDSGNEAGSS-------------QN--------------- 293
                       .|.:||......|.|....:.||:             ||               
Human    52 -----------TPFYSPQENVVFSSSRGPYDYGSNSFYQEKDMLSNCRQNTLGHNTQTSIAQDFS 105

  Fly   294 SGNGKKNPP------QIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRR 352
            |..|:..|.      ||||||:|:: ..|.|....:.:|.|..|:||||||||||||||||||||
Human   106 SEQGRTAPQDQKASIQIYPWMQRMN-SHSGVGYGADRRRGRQIYSRYQTLELEKEFHFNRYLTRR 169

  Fly   353 RRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMAS 387
            ||||||:|||||||||||||||||||||||..:.|
Human   170 RRIEIANALCLTERQIKIWFQNRRMKWKKESNLTS 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 48/52 (92%)
HOXC6NP_004494.1 Antp-type hexapeptide 122..127 4/4 (100%)
Homeobox 145..198 CDD:395001 48/52 (92%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..235 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.