DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and HOXC5

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_061826.1 Gene:HOXC5 / 3222 HGNCID:5127 Length:222 Species:Homo sapiens


Alignment Length:229 Identity:92/229 - (40%)
Similarity:113/229 - (49%) Gaps:61/229 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 NNNSANSNNNNSQSLASPQDLSTRDIS---PKLSPSSVVESVARSLNKGVLGGSLAAAAAAAGLN 251
            |..:..:..:.|:..||.......|:|   |..:||:.:..|..:.|........|.:||||   
Human    20 NMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDMAANPRAHPDRPACSAAAA--- 81

  Fly   252 NNHSGSGVSGGPGNVNVPMHSPG----------------------------GGDSDSESDSGNEA 288
                             |.|:||                            |...:.::.:|..|
Human    82 -----------------PGHAPGRDEAAPLNPGMYSQKAARPALEERAKSSGEIKEEQAQTGQPA 129

  Fly   289 GSSQNSGNGKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRR 353
            |.||...     ||||||||.::|:...|     :.||.||||||||||||||||||||||||||
Human   130 GLSQPPA-----PPQIYPWMTKLHMSHET-----DGKRSRTSYTRYQTLELEKEFHFNRYLTRRR 184

  Fly   354 RIEIAHALCLTERQIKIWFQNRRMKWKKEHKMAS 387
            |||||:.|||.|||||||||||||||||:.||.|
Human   185 RIEIANNLCLNERQIKIWFQNRRMKWKKDSKMKS 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 49/52 (94%)
HOXC5NP_061826.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..141 18/97 (19%)
Antp-type hexapeptide 140..145 4/4 (100%)
Homeobox 158..211 CDD:306543 48/52 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm40809
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.770

Return to query results.
Submit another query.