DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and HOXB5

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_002138.1 Gene:HOXB5 / 3215 HGNCID:5116 Length:269 Species:Homo sapiens


Alignment Length:386 Identity:122/386 - (31%)
Similarity:163/386 - (42%) Gaps:129/386 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MSSYQFVNSLASCYPQQMNPQQNHPGAGNSSAGGSGGGAGGSGGVVPSGGTNGGQGSAGAATPGA 72
            |||| ||||.:..||...:.|..:.|:|:|.:|                                
Human     1 MSSY-FVNSFSGRYPNGPDYQLLNYGSGSSLSG-------------------------------- 32

  Fly    73 NDYFPAAAAYTPNLYPNTPQAHYANQAAYGGQGNPDMVDYTQLQPQRLLLQQQQQQQQQQHAHAA 137
             .|...||.:|               .:||       .:|..:.     |...:......|   .
Human    33 -SYRDPAAMHT---------------GSYG-------YNYNGMD-----LSVNRSSASSSH---F 66

  Fly   138 AAVAAQQQQQLAQQQHPQQQQQQQQANISCKYAND---PVTPGGSGGGGVSGSNNNNNSANSNNN 199
            .||....:...|    |.|:.:.:||..||..::.   |.|.|.|.|.        ..||:|.::
Human    67 GAVGESSRAFPA----PAQEPRFRQAASSCSLSSPESLPCTNGDSHGA--------KPSASSPSD 119

  Fly   200 NSQSLASPQDLSTRDISPKLSPSSVVESVARSLNKGVLGGSLAAAAAAAGLNNNHSGSGVSGGPG 264
            .:.|.:|..:.:..|   :.|.||..|..|..|:    ..|||.|.                 |.
Human   120 QATSASSSANFTEID---EASASSEPEEAASQLS----SPSLARAQ-----------------PE 160

  Fly   265 NVNVPMHSPGGGDSDSESDSGNEAGSSQNSGNGKKNPPQIYPWMKRVHLGTSTVNANGETKRQRT 329
            .:.....:|.|                        ..|||:|||:::|:.......:|  ||.||
Human   161 PMATSTAAPEG------------------------QTPQIFPWMRKLHISHDMTGPDG--KRART 199

  Fly   330 SYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNI 390
            :|||||||||||||||||||||||||||||||||:|||||||||||||||||::|:.||::
Human   200 AYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 50/52 (96%)
HOXB5NP_002138.1 PRK07003 <67..>171 CDD:235906 32/139 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..173 31/155 (20%)
Antp-type hexapeptide 176..181 3/4 (75%)
Homeobox 198..251 CDD:395001 50/52 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I5853
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm40809
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4748
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.