DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and HOXB1

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_002135.2 Gene:HOXB1 / 3211 HGNCID:5111 Length:301 Species:Homo sapiens


Alignment Length:243 Identity:77/243 - (31%)
Similarity:101/243 - (41%) Gaps:37/243 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 SCKYANDPVTPGGSGGGGVSGSNNNNNSANSNNNNSQSL------ASPQDLSTRDISPKLSPSSV 224
            |...|.|.....|..|||:|......||.........:|      ::|...:....||...||..
Human    34 SSAQAVDSYASEGRYGGGLSSPAFQQNSGYPAQQPPSTLGVPFPSSAPSGYAPAACSPSYGPSQY 98

  Fly   225 VESVARSLNKGVLGGSLAAAAAAAGLNNNHSGSGVSGGP--------GNVNVPMHSPGGGDSDSE 281
            . .:.:|...|......:..|...||::.:...|...||        ||......:|...|..||
Human    99 Y-PLGQSEGDGGYFHPSSYGAQLGGLSDGYGAGGAGPGPYPPQHPPYGNEQTASFAPAYADLLSE 162

  Fly   282 SDSGNEAGSSQNSGNG--------KKNPPQIYPWMKRVHLGTSTVN--ANGETKRQRTSYTRYQT 336
             |......|..|:...        |:|||:           |:.|:  ..|.....||::|..|.
Human   163 -DKETPCPSEPNTPTARTFDWMKVKRNPPK-----------TAKVSEPGLGSPSGLRTNFTTRQL 215

  Fly   337 LELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHK 384
            .|||||||||:||:|.||:|||..|.|.|.|:||||||||||.||..:
Human   216 TELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQKKRER 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 35/52 (67%)
HOXB1NP_002135.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..77 11/42 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..149 5/21 (24%)
Antp-type hexapeptide 179..184 0/4 (0%)
Homeobox 207..259 CDD:278475 35/51 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..301 6/10 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.