DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and Hoxc5

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001101586.1 Gene:Hoxc5 / 315341 RGDID:1307584 Length:222 Species:Rattus norvegicus


Alignment Length:223 Identity:93/223 - (41%)
Similarity:116/223 - (52%) Gaps:49/223 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 NNNSANSNNNNSQSLASPQDLSTRDIS---PKLSPSSVVESVARSLNKGVLGGSLAAAAAAAGLN 251
            |..:..:..:.|:..||.......|:|   |..:||:.:..|..:.|........|.:||||   
  Rat    20 NMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDMAANPRAHPDRPACSAAAA--- 81

  Fly   252 NNHSGSGVSGGPGN---------VNVPMHS-------------PGGGDSDSESDSGNEAGSSQNS 294
                       ||:         :|..|:|             ..|...:.::.:|..||.||..
  Rat    82 -----------PGHALGRDEAAPLNPGMYSQKAARPALEERAKSSGEIKEEQAQTGQPAGLSQPP 135

  Fly   295 GNGKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAH 359
            .     ||||||||.::|:...|     :.||.|||||||||||||||||||||||||||||||:
  Rat   136 A-----PPQIYPWMTKLHMSHET-----DGKRSRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAN 190

  Fly   360 ALCLTERQIKIWFQNRRMKWKKEHKMAS 387
            .|||.|||||||||||||||||:.||.|
  Rat   191 NLCLNERQIKIWFQNRRMKWKKDSKMKS 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 49/52 (94%)
Hoxc5NP_001101586.1 COG5373 65..>142 CDD:227665 21/95 (22%)
Homeobox 158..212 CDD:395001 49/53 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm44950
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.770

Return to query results.
Submit another query.