DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and hoxb8b

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_571256.1 Gene:hoxb8b / 30420 ZFINID:ZDB-GENE-980526-291 Length:247 Species:Danio rerio


Alignment Length:81 Identity:53/81 - (65%)
Similarity:63/81 - (77%) Gaps:9/81 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 QIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQ 367
            |::|||:        ..|.|. :|.|.:|:|||||||||||.||.||||:||||::|||.|||||
Zfish   133 QLFPWMR--------PQATGR-RRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALALTERQ 188

  Fly   368 IKIWFQNRRMKWKKEH 383
            :|||||||||||||||
Zfish   189 VKIWFQNRRMKWKKEH 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 42/52 (81%)
hoxb8bNP_571256.1 Antp-type hexapeptide 134..139 2/4 (50%)
Homeobox 149..201 CDD:278475 41/51 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..247 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.