DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and hoxc5a

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_571219.2 Gene:hoxc5a / 30379 ZFINID:ZDB-GENE-980526-533 Length:233 Species:Danio rerio


Alignment Length:251 Identity:96/251 - (38%)
Similarity:126/251 - (50%) Gaps:57/251 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 QQQQQANISCK-----------------YANDPVTPGGSGGGGVSGSNNNNNSANSNNNNSQSLA 205
            :|.|.|: ||:                 ||.:.:..|||....:. :|:....|.:..:.::|.|
Zfish    11 KQTQDAS-SCRMHTFDNYGAHSEFHESNYAYEGLDLGGSFSSQIP-TNSLRREAINTTDRARSSA 73

  Fly   206 SPQDLSTRDISPKLSPSSVVESVARSLNKGVLGGSLAAAAAAAGLNNNHSGSGVSGGPGNVNVPM 270
            :.|  .|:..|...|.|.|.......|:.|:|.                     ....||:.| |
Zfish    74 AVQ--RTQSCSALGSRSFVSTHGYNPLSHGLLS---------------------QKAEGNMEV-M 114

  Fly   271 HSPGG----GDSDSESDSG--NEAGSSQNSGNGKKNPPQIYPWMKRVHLGTSTVNANGETKRQRT 329
            ..|.|    .|...|:.|.  .:..|:|..   .::.|||||||.::|:     :...:.||.||
Zfish   115 EKPSGKSRTDDIKMETTSAIKQQTNSTQRQ---NQSQPQIYPWMTKLHM-----SHESDGKRSRT 171

  Fly   330 SYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKM 385
            |||||||||||||||||||||||||||||:.|||.|||||||||||||||||:.|:
Zfish   172 SYTRYQTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKL 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 49/52 (94%)
hoxc5aNP_571219.2 Homeobox 169..222 CDD:278475 48/52 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm24551
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.