DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and hoxc6a

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_571198.1 Gene:hoxc6a / 30346 ZFINID:ZDB-GENE-990415-113 Length:231 Species:Danio rerio


Alignment Length:90 Identity:64/90 - (71%)
Similarity:72/90 - (80%) Gaps:1/90 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 KKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALC 362
            |.|..||||||:|:: ..|.|....:.:|.|..|:||||||||||||||||||||||||||:|||
Zfish   117 KANNIQIYPWMQRMN-SHSGVGYGSDRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALC 180

  Fly   363 LTERQIKIWFQNRRMKWKKEHKMAS 387
            ||||||||||||||||||||..:.|
Zfish   181 LTERQIKIWFQNRRMKWKKETNLTS 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 48/52 (92%)
hoxc6aNP_571198.1 Antp-type hexapeptide 123..128 4/4 (100%)
Homeobox 146..198 CDD:278475 47/51 (92%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..231 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.