DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and hoxc6a

DIOPT Version :10

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_571198.1 Gene:hoxc6a / 30346 ZFINID:ZDB-GENE-990415-113 Length:231 Species:Danio rerio


Alignment Length:90 Identity:64/90 - (71%)
Similarity:72/90 - (80%) Gaps:1/90 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 KKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALC 362
            |.|..||||||:|:: ..|.|....:.:|.|..|:||||||||||||||||||||||||||:|||
Zfish   117 KANNIQIYPWMQRMN-SHSGVGYGSDRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALC 180

  Fly   363 LTERQIKIWFQNRRMKWKKEHKMAS 387
            ||||||||||||||||||||..:.|
Zfish   181 LTERQIKIWFQNRRMKWKKETNLTS 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeodomain 325..381 CDD:459649 49/55 (89%)
hoxc6aNP_571198.1 Antp-type hexapeptide 123..128 4/4 (100%)
Homeodomain 143..199 CDD:459649 49/55 (89%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..231 2/6 (33%)

Return to query results.
Submit another query.