DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and hoxb6a

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_571194.1 Gene:hoxb6a / 30341 ZFINID:ZDB-GENE-990415-106 Length:228 Species:Danio rerio


Alignment Length:219 Identity:85/219 - (38%)
Similarity:109/219 - (49%) Gaps:46/219 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 DPVT--PGGSGGGGVSGSNNNNNSANSNNNNSQS---LASPQDLSTRDISPKLSPSSVVESVARS 231
            ||:.  ||.:.||.........:|.....|.:.|   .|.|.|.:|.....:..|:..:.|:...
Zfish    34 DPLRHYPGAAYGGSSVQEKAYPSSFYQQANGAYSRATAAGPCDYATASFYREKDPACALASIEEH 98

  Fly   232 LNKGVLGGSLAAAAAAAGLNNNHSGSGVSGGPGNVNVPMHSPGGGDSDSESDSGNEAGSSQNSGN 296
                           :..|:.:|..:..:|..|....|           |:|.            
Zfish    99 ---------------SFVLSQDHRKTDCTGSTGKSIYP-----------EADE------------ 125

  Fly   297 GKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHAL 361
             :|....:||||:|::....|....|  :|.|.:|||||||||||||||||||||||||||||||
Zfish   126 -QKPSAPVYPWMQRMNSCNGTFGNAG--RRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHAL 187

  Fly   362 CLTERQIKIWFQNRRMKWKKEHKM 385
            |||||||||||||||||||||:|:
Zfish   188 CLTERQIKIWFQNRRMKWKKENKL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 50/52 (96%)
hoxb6aNP_571194.1 Antp-type hexapeptide 132..137 3/4 (75%)
Homeobox 154..206 CDD:278475 49/51 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.