DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and hoxd4a

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001119917.1 Gene:hoxd4a / 30329 ZFINID:ZDB-GENE-980526-214 Length:256 Species:Danio rerio


Alignment Length:147 Identity:78/147 - (53%)
Similarity:93/147 - (63%) Gaps:15/147 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 HSGSGVSGGP----GNVNVPMHSPGGGDSDSE-----SDSGNEAGSSQ-----NSGNGKKNPPQI 304
            :|.|.|.|..    |:|.....:|....:.:|     ..||:..|..|     .:|...|.|..:
Zfish    81 YSCSTVQGSSVQPRGHVQDQASTPSPFPAQTEQCPAVQISGSRTGGQQQNTKTQNGIPTKQPAVV 145

  Fly   305 YPWMKRVHLGTSTVNANG-ETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQI 368
            |||||:||:.|...:..| |.||.||:|||.|.|||||||||||||||||||||||.|||:||||
Zfish   146 YPWMKKVHVTTVNPDYTGPEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQI 210

  Fly   369 KIWFQNRRMKWKKEHKM 385
            |||||||||||||:||:
Zfish   211 KIWFQNRRMKWKKDHKL 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 47/52 (90%)
hoxd4aNP_001119917.1 Homeobox 169..222 CDD:278475 46/52 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45771
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.