DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and hoxb5a

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_571176.2 Gene:hoxb5a / 30317 ZFINID:ZDB-GENE-980526-70 Length:275 Species:Danio rerio


Alignment Length:244 Identity:96/244 - (39%)
Similarity:128/244 - (52%) Gaps:26/244 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 ISCKYANDPVTPGGSGGGGVSGSNNNNNSANSN------NNNSQSLASP-------QDLSTRDIS 216
            ::..|.:......||.|...:|.:.:.|.:.|.      .:||:...||       |..|....|
Zfish    31 MNASYRDSGTMHSGSYGYNYNGMDLSVNRSTSTGHFGAVGDNSRVFQSPAPETRFRQPSSCSLAS 95

  Fly   217 PKLSPSSVVESVARSLNKGVLGGS----LAAAAAAAGLNNNHSGSGVSGGPGNVNVPMHSPGGGD 277
            |:..|.|..||:      |..|.|    .:...|...||:|...:.:.....:......|....:
Zfish    96 PEPLPCSNSESL------GPKGSSPPSDQSTTTAGNNLNSNTHFTEIDEASASSETEEASHRANN 154

  Fly   278 SDSESDSGNE-AGSSQNSGNGKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEK 341
            |...:....| ..:|..|.......|||:|||:::|:.......:|  ||.||:|||||||||||
Zfish   155 SAPRTQQKQETTATSTTSATSDGQAPQIFPWMRKLHISHDMTGPDG--KRARTAYTRYQTLELEK 217

  Fly   342 EFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNI 390
            ||||||||||||||||||||||:|||||||||||||||||::|:.||::
Zfish   218 EFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSL 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 50/52 (96%)
hoxb5aNP_571176.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..181 24/116 (21%)
Antp-type hexapeptide 182..187 3/4 (75%)
Homeobox 204..256 CDD:278475 49/51 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I5816
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 149 1.000 Inparanoid score I4355
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm24551
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4748
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.850

Return to query results.
Submit another query.