DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and Hoxd4

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001099355.1 Gene:Hoxd4 / 288153 RGDID:1309690 Length:251 Species:Rattus norvegicus


Alignment Length:261 Identity:93/261 - (35%)
Similarity:116/261 - (44%) Gaps:90/261 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 LSTRDISPKLSPSSVVESVARSLNKGVLGGSLAAAAAAAGLNNNHSGSGVSG------------- 261
            ::::.:.||..|          ..:.:.||.|....|      ::.|||..|             
  Rat     8 VNSKYVDPKFPP----------CEEYLQGGYLGEQGA------DYYGSGAQGSDFQPPGLYPRPD 56

  Fly   262 -----------GPGNVNVPMHSPGGGDSDSESDSGNE-------------------------AGS 290
                       |||:.     .|..|.....|..|:.                         .|.
  Rat    57 FGEQPFGGGGPGPGSA-----LPARGHGQEPSGPGSHYSAPGEPCPAPPPAPLPGARACSQPTGP 116

  Fly   291 SQ-NSGNGKKNPPQIYPWMKRVHLGTSTVNAN---GETKRQRTSYTRYQTLELEKEFHFNRYLTR 351
            .| ..|...|.|..:|||||:||:  ::||.|   ||.||.||:|||.|.|||||||||||||||
  Rat   117 KQPPPGTALKQPAVVYPWMKKVHV--NSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTR 179

  Fly   352 RRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKM-------------ASMNIVP-YHMGPYGHPY 402
            ||||||||.|||:|||||||||||||||||:||:             .|.:..| .|:.|....:
  Rat   180 RRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSCSSSAAPSQHLQPMAKDH 244

  Fly   403 H 403
            |
  Rat   245 H 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 47/52 (90%)
Hoxd4NP_001099355.1 Homeobox 155..209 CDD:395001 47/53 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45771
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.