DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and Bsx

DIOPT Version :10

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_839976.1 Gene:Bsx / 244813 MGIID:2669849 Length:232 Species:Mus musculus


Alignment Length:81 Identity:32/81 - (39%)
Similarity:46/81 - (56%) Gaps:4/81 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 PQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTER 366
            |.::|..:...|    ...:...::.||.::..|...|||.|...|||:...|:|:|.||.|:|.
Mouse    92 PALFPHPQHAEL----PGKHCRRRKARTVFSDSQLSGLEKRFEIQRYLSTPERVELATALSLSET 152

  Fly   367 QIKIWFQNRRMKWKKE 382
            |:|.||||||||.||:
Mouse   153 QVKTWFQNRRMKHKKQ 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeodomain 325..381 CDD:459649 27/55 (49%)
BsxNP_839976.1 Homeodomain 111..167 CDD:459649 27/55 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..232 7/9 (78%)

Return to query results.
Submit another query.