DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and Hoxc8

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001170797.2 Gene:Hoxc8 / 24460 RGDID:2821 Length:242 Species:Rattus norvegicus


Alignment Length:214 Identity:79/214 - (36%)
Similarity:102/214 - (47%) Gaps:53/214 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 PGGSGGGGVSGSN------NNNNSANSNNNNSQSLASPQDLSTRDISPKLSPSSVVESVARSLNK 234
            ||||..|....|:      ::..|..||:...|   :|..||....:.|...   .|::.|.   
  Rat    42 PGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQ---NPCSLSCHGDASKFYG---YEALPRQ--- 97

  Fly   235 GVLGGSLAAAAAAAGLNNNHSGSGVSGGPGNVNVPMHSPGGGDSDSESDSGNEAGSSQNSGNGKK 299
                 ||..|...|.:               |..|         |.:|.:...:...|...|...
  Rat    98 -----SLYGAQQEASV---------------VQYP---------DCKSSANTNSSEGQGHLNQNS 133

  Fly   300 NPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLT 364
            :|..::||| |.|       |.|. :..|.:|:|||||||||||.||.||||:||||::|||.||
  Rat   134 SPSLMFPWM-RPH-------APGR-RSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLT 189

  Fly   365 ERQIKIWFQNRRMKWKKEH 383
            |||:||||||||||||||:
  Rat   190 ERQVKIWFQNRRMKWKKEN 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 42/52 (81%)
Hoxc8NP_001170797.2 Homeobox 153..206 CDD:395001 42/52 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.