DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and Hoxc4

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001103354.1 Gene:Hoxc4 / 24459 RGDID:1586210 Length:264 Species:Rattus norvegicus


Alignment Length:306 Identity:97/306 - (31%)
Similarity:129/306 - (42%) Gaps:101/306 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 PNTPQAHYANQAAYGGQGNPDMVDYTQLQPQRLLLQQQQQQQQQQHAHAAAAVAAQQQQQLAQQQ 152
            |..|.....:|.:|..:.:|:....|             ::...||.|          |:|....
  Rat    15 PKFPPCEEYSQNSYIPEHSPEYYGRT-------------RESGFQHHH----------QELYPPP 56

  Fly   153 HPQQQQQQQQANISCKYANDPVTPGGSGGGGVSGSNNNNNSANSNNNNSQSLASPQDLSTRDISP 217
            .|:....::|  .||.....|         |.|.::....:.:.:...||.|..|..||....||
  Rat    57 PPRPSYPERQ--YSCTSLQGP---------GNSRAHGPAQAGHHHPEKSQPLCEPAPLSGASASP 110

  Fly   218 KLSPSSVVESVARSLNKGVLGGSLAAAAAAAGLNNNHSGSGVSGGPGNVNVPMHSPGGGDSDSES 282
            ..:|.:.                                                     |....
  Rat   111 SPAPPAC-----------------------------------------------------SQPAP 122

  Fly   283 DSGNEAGSSQNSGNGKKNPPQIYPWMKRVHLGTSTVNAN---GETKRQRTSYTRYQTLELEKEFH 344
            |..:.|.|.|         |.:|||||::|:  ||||.|   ||.||.||:|||.|.||||||||
  Rat   123 DHPSSAASKQ---------PIVYPWMKKIHV--STVNPNYNGGEPKRSRTAYTRQQVLELEKEFH 176

  Fly   345 FNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNI 390
            :||||||||||||||:|||:|||||||||||||||||:|::.:..:
  Rat   177 YNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDHRLPNTKV 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 46/52 (88%)
Hoxc4NP_001103354.1 Homeobox 159..213 CDD:395001 46/53 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.