DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and GSX1

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_663632.1 Gene:GSX1 / 219409 HGNCID:20374 Length:264 Species:Homo sapiens


Alignment Length:270 Identity:75/270 - (27%)
Similarity:93/270 - (34%) Gaps:126/270 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 SLNKGVLGGSLAAAAAAAGLNNNHSGSGVSGGPGNVNVPMHSPGGGDSDSESDSGNEAGSSQNSG 295
            :::.||..|..|||||||....::              |:..|......|...|.|:..||    
Human   101 AVSPGVAHGPAAAAAAAALYQTSY--------------PLPDPRQFHCISVDSSSNQLPSS---- 147

  Fly   296 NGKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHA 360
                                         ||.||::|..|.||||:||..|.||:|.||||||..
Human   148 -----------------------------KRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATY 183

  Fly   361 LCLTERQIKIWFQNRRMKWKKEHKMASMNIVPYHMGPYGHPYHQFDIHPSQFAHLSAXDAWHFSG 425
            |.|:|:|:||||||||:|.|||.|                                        |
Human   184 LNLSEKQVKIWFQNRRVKHKKEGK----------------------------------------G 208

  Fly   426 TGXRLNQLYQEPYQTAAAASAASGYQSQDGGPIGGGSVGVGGGAGGPGSLANGGSNGSGPNSLFA 490
            :..|                             |||    ||||||      |||...|......
Human   209 SNHR-----------------------------GGG----GGGAGG------GGSAPQGCKCASL 234

  Fly   491 SAASSSQAPD 500
            |:|..|:..|
Human   235 SSAKCSEDDD 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 33/52 (63%)
GSX1NP_663632.1 SNAG domain. /evidence=ECO:0000250 1..20
Homeobox 151..204 CDD:395001 33/52 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..264 24/123 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.