DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and php-3

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_499573.1 Gene:php-3 / 176640 WormBaseID:WBGene00004024 Length:275 Species:Caenorhabditis elegans


Alignment Length:267 Identity:81/267 - (30%)
Similarity:118/267 - (44%) Gaps:61/267 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 AHAAAAVAAQQQQQLAQQQHPQQQQQQQQANISCKYANDPVTPGGSGGGGVSGSNN--NNNSANS 196
            |..::|.||..|......:..|.||....::            |.|.|...|.|||  ...:.|.
 Worm    44 ATTSSAAAAAMQHNFWSTRAAQLQQSVSGSS------------GVSSGSSSSASNNLSRTQADNH 96

  Fly   197 NNNNSQSLASPQDLSTRDISPKLSPSSVVESVARSLNKGVLGGSLAAAAAAAGLNNNHSGSGVSG 261
            :...|.:.:|||      ::|  .|:|              .|....||||||:...::|.    
 Worm    97 SERGSDTASSPQ------VAP--LPTS--------------SGMSMPAAAAAGMYPFNAGR---- 135

  Fly   262 GPGNVNVPMHSPGGGDSDSESDSGNE-----------AGSSQNSGNGKKNPPQIYPWMKRVHLGT 315
            .|...|:.::.....|..|.|.:.:.           |..|..|.:|..|......|       |
 Worm   136 FPTEFNMMVNQSMYNDFYSNSLAASSWPYSYPQQYPFANYSMPSLDGNLNDGGQLEW-------T 193

  Fly   316 STVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWK 380
            |:.:|   .:::|..||:.|||||||||.:|.|:::::|.|:|..|.|||||:||||||||||.|
 Worm   194 SSSHA---MRKKRKPYTKAQTLELEKEFLYNTYVSKQKRWELAKYLHLTERQVKIWFQNRRMKDK 255

  Fly   381 KEHKMAS 387
            |:.:..|
 Worm   256 KQKQRTS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 33/52 (63%)
php-3NP_499573.1 Homeobox 202..256 CDD:365835 33/53 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.