DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and egl-5

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001021166.1 Gene:egl-5 / 176093 WormBaseID:WBGene00001174 Length:223 Species:Caenorhabditis elegans


Alignment Length:208 Identity:59/208 - (28%)
Similarity:88/208 - (42%) Gaps:51/208 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 GSGGGGVSGSNNNNNSANSNNNNSQSLASPQDLSTRDISPKLSPSSVVESVARSLNKGVLGGSLA 242
            ||.....:.::..::..::|::.|:..|..|.:...|.....:||:     ..||..|:    .|
 Worm    11 GSSTASSAATSTTSSQPDANDHLSRLAAMTQGVGKEDPETSSTPST-----EASLYPGI----SA 66

  Fly   243 AAAAAAGLNNNHSGSGVSGGPGNVNVPMHSPGGGDSDSESDSGNEAGSSQNSGNGKKNPPQIYP- 306
            |...:.|...|::..|...||...      ||.                          ||.|| 
 Worm    67 AYMQSYGWPQNYNYFGQPLGPATF------PGW--------------------------PQCYPN 99

  Fly   307 --WMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIK 369
              |.....|..|       :|:.|.:|.||||..||.:|..:.|:::::|.|:.....||:||||
 Worm   100 TAWPNYGELFAS-------SKKGRQTYQRYQTSVLEAKFQQSSYVSKKQREELRLQTQLTDRQIK 157

  Fly   370 IWFQNRRMKWKKE 382
            |||||||||.|||
 Worm   158 IWFQNRRMKAKKE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 27/52 (52%)
egl-5NP_001021166.1 Homeobox 116..168 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.