DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and mab-5

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_498695.1 Gene:mab-5 / 176091 WormBaseID:WBGene00003102 Length:200 Species:Caenorhabditis elegans


Alignment Length:170 Identity:71/170 - (41%)
Similarity:96/170 - (56%) Gaps:29/170 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 ARSLNKGVLGGSLAAAAAAAGLNN-------NHSGSGVSGGPGNVNVPMHSPGGGDSDSESDS-- 284
            ::|.:.|....:.::|||||..||       ||:         .:|...|....|..|:.|:.  
 Worm    23 SQSASSGTSASASSSAAAAAAANNLKTYELYNHT---------YMNNMKHMLAAGWMDNSSNPFA 78

  Fly   285 -GNEAGSSQNSGNGKKNPPQI----YPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFH 344
             .....:|.|.|..:.:.|.|    :||||   :|.:   ..||:||.|.:|:|.||||||||||
 Worm    79 YNPLQATSANFGETRTSMPAISQPVFPWMK---MGGA---KGGESKRTRQTYSRSQTLELEKEFH 137

  Fly   345 FNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHK 384
            :::||||:||.||:..|.|||||:||||||||||.|||.|
 Worm   138 YHKYLTRKRRQEISETLHLTERQVKIWFQNRRMKHKKEAK 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 37/52 (71%)
mab-5NP_498695.1 Homeobox 120..173 CDD:278475 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166701
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45771
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.800

Return to query results.
Submit another query.