DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and DLX3

DIOPT Version :10

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_005211.1 Gene:DLX3 / 1747 HGNCID:2916 Length:287 Species:Homo sapiens


Alignment Length:80 Identity:34/80 - (42%)
Similarity:45/80 - (56%) Gaps:6/80 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 NGETK---RQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 382
            ||:.|   :.||.|:.||...|::.|...:||....|.|:|..|.||:.|:||||||||.|:||.
Human   123 NGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKL 187

  Fly   383 HKMASMNIVPYHMGP 397
            :|...   ||....|
Human   188 YKNGE---VPLEHSP 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeodomain 325..381 CDD:459649 26/58 (45%)
DLX3NP_005211.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..39
DLL_N 27..107 CDD:463567
COG5576 <109..232 CDD:227863 34/80 (43%)
homeobox 129..188 27/58 (47%)
Homeodomain 130..186 CDD:459649 25/55 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..287 1/5 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.