DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and Meox1

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_036012267.1 Gene:Meox1 / 17285 MGIID:103220 Length:271 Species:Mus musculus


Alignment Length:276 Identity:55/276 - (19%)
Similarity:95/276 - (34%) Gaps:72/276 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NPQQ--------NHPGAGNSSAGGSGGGAGGSGGVVPSGGTNGGQGSAGAATPGANDYFPAAAAY 82
            |||.        .:|.:.:|||.|...        .|....:..|.|...||....|:..:..|.
Mouse    11 NPQPPAPVWGCLRNPHSEDSSASGLSH--------YPPTPFSFHQKSDFPATAAYPDFSASCLAA 67

  Fly    83 TPN--------------LYPNTPQAHY-------------ANQAAYGGQGNPDMVDYTQ-LQPQR 119
            ||:              .:|.||..|:             |..|...|.|:|.:||.|. |....
Mouse    68 TPHSLPRTERIFNEQHPAFPQTPDWHFPISEAGQRLNLGPAGSAREMGAGSPGLVDGTAGLGEDC 132

  Fly   120 LLLQQQQQQQQQQHAHAAAAVAAQQQQQLAQQQHPQQQQQQQQANISCKYANDPVTPGGSG--GG 182
            ::|.....:.:::.:.       :::::..|...|:.:.:.:    :|: ......|.|:|  |.
Mouse   133 MVLGTIANETEKKSSR-------RKKERSGQSLVPEPEDEVE----TCE-GGSACVPTGAGPRGW 185

  Fly   183 GVSGSNNNNNSANSNNNNSQSLASP-----------QDLSTRDISPKLSPSSVVESVARSLN--K 234
            |:. |.:......|.:.|.:.|..|           ..|.|....|..:....|.....:||  :
Mouse   186 GLC-SFSKFRVRCSKDQNQERLKEPPLQFPPPGPTLSHLWTHPGQPAHTLRCEVAQYVGALNFPE 249

  Fly   235 GVLGGSLAAAAAAAGL 250
            |:......:||.:.||
Mouse   250 GLAQRPYISAAPSPGL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001
Meox1XP_036012267.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.