DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and ceh-12

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_491693.1 Gene:ceh-12 / 172255 WormBaseID:WBGene00000436 Length:180 Species:Caenorhabditis elegans


Alignment Length:196 Identity:63/196 - (32%)
Similarity:92/196 - (46%) Gaps:49/196 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 ANSNNNNSQSLASPQDLSTRDISPKLSPSSVVESVARSLNKGVLGGSLAAA--AAAAGLNNNHSG 256
            :.|:.|..|.|.|..           ||.|.:.:.:.|.::.::..:..||  ||.|.|.|:.|.
 Worm    13 STSSQNEDQKLESHP-----------SPPSQIPNYSTSCSEELMKMAAKAAQFAAQASLENSFSS 66

  Fly   257 SGVSGGPGNVNVPMHSPGGGDSDSESDSGNEAGSSQNSGNGKKNP--PQIYPWMKRVHLG-TSTV 318
               |..|.:...|:                      ::......|  |.||.     ||. |.:|
 Worm    67 ---STSPTSTVTPL----------------------SAYTSLVQPVLPLIYD-----HLALTYSV 101

  Fly   319 N---ANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWK 380
            |   |.|:.:|.||:::..|.::|||:|..||||:|.||.::|..|.|:|.||||||||||||.|
 Worm   102 NAWQAWGKMRRPRTAFSSEQLVQLEKQFSDNRYLSRPRRYQLAQQLSLSETQIKIWFQNRRMKNK 166

  Fly   381 K 381
            :
 Worm   167 R 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 30/52 (58%)
ceh-12NP_491693.1 Homeobox 113..166 CDD:278475 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.