DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and GSX2

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_573574.2 Gene:GSX2 / 170825 HGNCID:24959 Length:304 Species:Homo sapiens


Alignment Length:361 Identity:90/361 - (24%)
Similarity:116/361 - (32%) Gaps:170/361 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NSSAGGSGGGAGGSGGVVPSGGTNGGQGSAGA--ATPGANDYFPAAAAYTPNL-----YPNTPQA 93
            :||.|..|.|:||:|..|...|.:|..|:|||  ...|.....|..|.:.|.:     :.:.||.
Human    70 HSSRGSVGAGSGGAGAGVTGAGGSGVAGAAGALPLLKGQFSSAPGDAQFCPRVNHAHHHHHPPQH 134

  Fly    94 HYANQAAYGGQGNPDMVDYTQLQPQRLLLQQQQQQQQQQHAHAAAAVAAQQQQQLAQQQHPQQQQ 158
            |:                             ...|.||..:.||||.||......|...|||.  
Human   135 HH-----------------------------HHHQPQQPGSAAAAAAAAAAAAAAAALGHPQH-- 168

  Fly   159 QQQQANISCKYANDPVTPGGSGGGGVSGSNNNNNSANSNNNNSQSLASPQDLSTRDISPKLSPSS 223
                        :.||.                 :|.:.|     :|.|                
Human   169 ------------HAPVC-----------------TATTYN-----VADP---------------- 183

  Fly   224 VVESVARSLNKGVLGGSLAAAAAAAGLNNNHSGSGVSGGPGNVNVPMHSPGGGDSDSESDSGNEA 288
                  |..:...:|||.|:                       .||                   
Human   184 ------RRFHCLTMGGSDAS-----------------------QVP------------------- 200

  Fly   289 GSSQNSGNGKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRR 353
                                            ||  ||.||::|..|.||||:||..|.||:|.|
Human   201 --------------------------------NG--KRMRTAFTSTQLLELEREFSSNMYLSRLR 231

  Fly   354 RIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMN 389
            |||||..|.|:|:|:||||||||:|.|||.|....|
Human   232 RIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGTQRN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 33/52 (63%)
GSX2NP_573574.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..151 10/63 (16%)
Homeobox 206..258 CDD:306543 33/51 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..304
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.