DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and Hoxb6

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_006532355.1 Gene:Hoxb6 / 15414 MGIID:96187 Length:309 Species:Mus musculus


Alignment Length:278 Identity:101/278 - (36%)
Similarity:131/278 - (47%) Gaps:74/278 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 KYANDPVT----PGGSGGGGVSGSNNNNNSANSNNNN--SQSLASPQDLSTRDISPKLSPSSVV- 225
            |..|.|::    |..||||     .|..:||.:..::  :|.:.:|.: ..|..:|.|..||.. 
Mouse    33 KIPNAPLSLPPHPFESGGG-----QNPPSSAKARRSDYKTQQIINPAE-QQRPRAPPLPMSSYFV 91

  Fly   226 ------------ESVARSL------------------------NKGV--------LGGSLAAAA- 245
                        ||....|                        :||.        .||....|| 
Mouse    92 NSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFAASSYYPPAGGGYGRAAP 156

  Fly   246 -----AAAGLNNNHSGSGVSGGPGNVNVPMHSPGGGDSDSESDSGNEAGSSQNSGNGKKNPPQIY 305
                 |.|......:...:||  .:...|.| |....||...|. :..|.::.    :|....:|
Mouse   157 CDYGPAPAFYREKDAACALSG--ADEPPPFH-PEPRKSDCAQDK-SVFGETEE----QKCSTPVY 213

  Fly   306 PWMKRVH-LGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIK 369
            |||:|:: ..:|:...:|  :|.|.:||||||||||||||:||||||||||||||||||||||||
Mouse   214 PWMQRMNSCNSSSFGPSG--RRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIK 276

  Fly   370 IWFQNRRMKWKKEHKMAS 387
            |||||||||||||.|:.|
Mouse   277 IWFQNRRMKWKKESKLLS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 49/52 (94%)
Hoxb6XP_006532355.1 Homeobox 235..288 CDD:365835 49/52 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.