DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scr and Hoxb1

DIOPT Version :9

Sequence 1:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_006532343.1 Gene:Hoxb1 / 15407 MGIID:96182 Length:330 Species:Mus musculus


Alignment Length:269 Identity:80/269 - (29%)
Similarity:102/269 - (37%) Gaps:57/269 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 GGGVSGSNNNNNSANSNNNNSQSLA------SPQDLSTRDISPKLSPSSVVESVARSLNKGVLGG 239
            |||:..|....||.........||.      :|...:....:|...||... ||.:|...|....
Mouse    46 GGGLPSSALQQNSGYPVQQPPSSLGVSFPSPAPSGYAPAACNPSYGPSQYY-SVGQSEGDGSYFH 109

  Fly   240 SLAAAAAAAGLNNNHSGSGVSGGPGNVNVPMHSPGGGDSDSESDSGNEAGSSQNSGNGKKNP--- 301
            ..:..|...||.:::...||..||   ..|...|.|.:..:...|..:..|..........|   
Mouse   110 PSSYGAQLGGLPDSYGAGGVGSGP---YPPPQPPYGTEQTATFASAYDLLSEDKESPCSSEPSTL 171

  Fly   302 -PQIYPWMK------------RVHLGTSTVNANGETKRQ-------------------------- 327
             |:.:.|||            |.|. .|...|..|....                          
Mouse   172 TPRTFDWMKVKRNPPKTGRAQRSHF-LSLARAYTEGPEPGLHSFLQLLLLAAKVSELGLGAPGGL 235

  Fly   328 RTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNIVP 392
            ||::|..|..|||||||||:||:|.||:|||..|.|.|.|:||||||||||.||..:....  :|
Mouse   236 RTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQKKREREGGR--MP 298

  Fly   393 YHMGPYGHP 401
              .||.|.|
Mouse   299 --AGPPGCP 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 35/52 (67%)
Hoxb1XP_006532343.1 Homeobox 236..289 CDD:365835 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.